PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_42380
Common NameKK1_041148
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NF-YB
Protein Properties Length: 180aa    MW: 19883.7 Da    PI: 6.4984
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_42380genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB132.11.8e-41187894
          NF-YB  8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
                   +P++n++rim+kvlP +ak++++aket+q cvsefi+f+tsea+++cq+e+r+ ++++d+lwa+ tlGf++yv pl  +lk+yr+ e
  C.cajan_42380  1 MPVTNLVRIMRKVLPPQAKVAEQAKETMQVCVSEFIGFITSEANERCQKEHRRIVTAEDILWAMDTLGFDNYVGPLVSFLKRYRQSE 87
                   7***********************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.3E-36187IPR009072Histone-fold
SuperFamilySSF471131.93E-28187IPR009072Histone-fold
PfamPF008089.7E-21164IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.8E-122846No hitNo description
PRINTSPR006152.8E-124765No hitNo description
PRINTSPR006152.8E-126684No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MPVTNLVRIM RKVLPPQAKV AEQAKETMQV CVSEFIGFIT SEANERCQKE HRRIVTAEDI  60
LWAMDTLGFD NYVGPLVSFL KRYRQSEVPN LGGRGRVPLP QVVGTYPIIS SSSSPSPSPS  120
PSLLSPQYMM ACYGPNFPPS QNWCQGMFDS SGMCEFYDDA SGGSGNVVSD FDPLNIHKRA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B4e-31185892Transcription factor HapC (Eurofung)
4g92_B4e-31185892Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A151R5451e-133A0A151R545_CAJCA; Nuclear transcription factor Y subunit B-9
STRINGGLYMA07G39820.12e-39(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.11e-40NF-YB family protein